HPA014467

KLHDC8B antibody from Sigma-Aldrich
MGC35097
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014467
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014467, RRID:AB_1852565
Product name
Anti-KLHDC8B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014467
Antibody type
Polyclonal
Antigen
Kelch domain-containing protein 8B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPTPCYGASTFLHGNKIYVLGGRQGKLPVTAFEAF
DLEARTWTRHPSLPSRRAFAGCAMAEGSVFSLGGL
QQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSL
RMRDKRADFVVGSL
Storage
-20C
Provider Type Product Number
- No reagents -