HPA014467

KLHDC8B antibody from Atlas Antibodies
MGC35097
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014467
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014467, RRID:AB_1234657
Product name
Anti-KLHDC8B
Provider product page
Atlas Antibodies - HPA014467
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPTPCYGASTFLHGNKIYVLGGRQGKLPVTAFEAF
DLEARTWTRHPSLPSRRAFAGCAMAEGSVFSLGGL
QQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSL
RMRDKRADFVVGSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -