HPA031087

NPR1 antibody from MilliporeSigma / Merck KGaA
ANPa, ANPRA, GUCY2A, NPRA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031087
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031087, RRID:AB_10601975
Product name
Anti-NPR1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031087
Antibody type
Polyclonal
Antigen
natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHLDIFGQSLQGGQGPAPRRPWERGDGQDVSARQA
FQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFT
MEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVT
DGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSL
WDMDPENG
Storage
-20C
Provider Type Product Number
- No reagents -