Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000815 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-L3MBTL2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SYNSSVGSESSSYLEESSEAENEDREAGELPTSPL
HLLSPGTPRSLDGSGSEPAVCEMCGIVGTREAFFS
KTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKK
AKVLHKAAWSAKIGAFLHSQGTGQLADGTPTGQDA
LVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWED
VM- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references L3MBTL2 regulates chromatin remodeling during spermatogenesis
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Systematically generated antibodies against human gene products: High throughput screening on sections from the rat nervous system
Meng C, Liao J, Zhao D, Huang H, Qin J, Lee T, Chen D, Chan W, Xia Y
Cell Death & Differentiation 2019;26(11):2194-2207
Cell Death & Differentiation 2019;26(11):2194-2207
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
Systematically generated antibodies against human gene products: High throughput screening on sections from the rat nervous system
Mulder J, Wernérus H, Shi T, Pontén F, Hober S, Uhlén M, Hökfelt T
Neuroscience 2007;146(4):1689-1703
Neuroscience 2007;146(4):1689-1703
No comments: Submit comment
No validations: Submit validation data