HPA000815

L3MBTL2 antibody from Sigma-Aldrich
dJ756G23.3, DKFZP761I141, H-l(3)mbt-l
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000815
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000815, RRID:AB_1079220
Product name
Anti-L3MBTL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000815
Antibody type
Polyclonal
Antigen
Lethal(3)malignant brain tumor-like 2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYNSSVGSESSSYLEESSEAENEDREAGELPTSPL
HLLSPGTPRSLDGSGSEPAVCEMCGIVGTREAFFS
KTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKK
AKVLHKAAWSAKIGAFLHSQGTGQLADGTPTGQDA
LVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWED
VM
Storage
-20C
Provider Type Product Number
- No reagents -