HPA010553

MFAP5 antibody from Sigma-Aldrich
MAGP2, MP25
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010553
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010553, RRID:AB_1853843
Product name
Anti-MFAP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010553
Antibody type
Polyclonal
Antigen
Microfibrillar-associated protein 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVL
AVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRL
YSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVC
KEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCEN
V
Storage
-20C
Provider Type Product Number
- No reagents -