HPA023689

PYGO2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023689
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023689, RRID:AB_1855974
Product name
Anti-PYGO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023689
Antibody type
Polyclonal
Antigen
Pygopus homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPF
PGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGS
PAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKA
GGGSGPQPPPGLVYPCGA
Storage
-20C
Provider Type Product Number
- No reagents -