HPA025820

ZBTB7B antibody from Sigma-Aldrich
c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025820, RRID:AB_1859045
Product name
Anti-ZBTB7B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025820
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 7B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAA
CMEILQGSGLEAPSPDEDDCERARQYLEAFATATA
SGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRK
AFLQTKG
Storage
-20C
Provider Type Product Number
- No reagents -