Antibody data

Product number
H00149095-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00149095-M04, RRID:AB_1137160
Product name
DCST1 monoclonal antibody (M04), clone 2C12
Provider product page
Abnova Corporation - H00149095-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DCST1.
Antigen sequence
MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCL
LQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLKK
RAAFTKLRRAAILRRERQQKAPRHPLADI
Isotype
IgG
Antibody clone number
2C12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -