Antibody data

Product number
ABIN310462
Provider
antibodies-online
Product name
anti-DC-STAMP Domain Containing 1 (DCST1) antibody
Provider product page
antibodies-online - ABIN310462
Antibody type
Polyclonal
Antigen
The immunogen for anti-DCST1 antibody: synthetic peptide directed towards the C terminal of human DCST1
Reactivity
Human, Rat, Canine
Host
Rabbit
Antigen sequence
SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELS
SSAFS DSNDDTAYAG
Vial size
50 µg
Provider Type Product Number
- No reagents -