AV43421

DCST1 antibody from Sigma-Aldrich
FLJ32785
No application information provided.

Antibody data

Product number
AV43421
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV43421, RRID:AB_1847518
Product name
Anti-DCST1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV43421
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human DCST1 with an internal ID of P25204
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELS
SSAFSDSNDDTAYAG
Storage
-20C
Provider Type Product Number
- No reagents -