HPA005896

SCAMP3 antibody from Sigma-Aldrich
C1orf3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005896
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005896, RRID:AB_1856606
Product name
Anti-SCAMP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005896
Antibody type
Polyclonal
Antigen
Secretory carrier-associated membrane protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTV
STMYY
Storage
-20C
Provider Type Product Number
- No reagents -