HPA017046

ARHGEF2 antibody from Sigma-Aldrich
GEF-H1, KIAA0651, LFP40, P40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017046
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017046, RRID:AB_1852820
Product name
Anti-ARHGEF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017046
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRG
RSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQST
DSLNMRNRTLSVESLIDEEVIYSELMSDFEMDEKD
FAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQ
Storage
-20C
Provider Type Product Number
- No reagents -