Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005832-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005832-M01, RRID:AB_605923
- Product name
- ALDH18A1 monoclonal antibody (M01), clone 2B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALDH18A1.
- Antigen sequence
TDVIVTEDENTAEFFLQHVDSACVFWNASTRFSDG
YRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLR
GKDHVVSDFSEHGSLKYLHENLPIPQRNTN- Isotype
- IgG
- Antibody clone number
- 2B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional specialization in proline biosynthesis of melanoma.
De Ingeniis J, Ratnikov B, Richardson AD, Scott DA, Aza-Blanc P, De SK, Kazanov M, Pellecchia M, Ronai Z, Osterman AL, Smith JW
PloS one 2012;7(9):e45190
PloS one 2012;7(9):e45190
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALDH18A1 monoclonal antibody (M01), clone 2B5 Western Blot analysis of ALDH18A1 expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ALDH18A1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol