HPA008333

ALDH18A1 antibody from Atlas Antibodies
GSAS, P5CS, PYCS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008333
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008333, RRID:AB_888332
Product name
Anti-ALDH18A1
Provider product page
Atlas Antibodies - HPA008333
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEI
LLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQ
SGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRR
NLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQ
GVNVISVKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -