HPA008333

ALDH18A1 antibody from Sigma-Aldrich
GSAS, P5CS, PYCS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008333
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008333, RRID:AB_1078125
Product name
Anti-ALDH18A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008333
Antibody type
Polyclonal
Antigen
Delta1-pyrroline-5-carboxylate synthetase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEI
LLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQ
SGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRR
NLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQ
GVNVISVKD
Storage
-20C
Provider Type Product Number
- No reagents -