HPA004135

CRABP2 antibody from Sigma-Aldrich
CRABP-II
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004135
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004135, RRID:AB_1846516
Product name
Anti-CRABP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004135
Antibody type
Polyclonal
Antigen
Cellular retinoic acid-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVD
GRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRE
LTNDGELILTMTADDVVCTRVYVRE
Storage
-20C
Provider Type Product Number
- No reagents -