HPA028005

ISG20L2 antibody from Atlas Antibodies
FLJ12671
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA028005
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028005, RRID:AB_2126319
Product name
Anti-ISG20L2
Provider product page
Atlas Antibodies - HPA028005
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLL
ERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -