HPA028005

ISG20L2 antibody from Sigma-Aldrich
FLJ12671
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028005
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028005, RRID:AB_2126319
Product name
Anti-ISG20L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028005
Antibody type
Polyclonal
Antigen
Interferon-stimulated 20 kDa exonuclease-like 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLL
ERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVD
Storage
-20C
Provider Type Product Number
- No reagents -