HPA019483

SH2D2A antibody from Sigma-Aldrich
F2771, TSAd
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019483
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019483, RRID:AB_1856809
Product name
Anti-SH2D2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019483
Antibody type
Polyclonal
Antigen
SH2 domain-containing protein 2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQN
TGGSQLHSENSVIGQGPPLPHQPPPAWRHTLPHNL
SRQVLQDRGQAWLPLGPPQ
Storage
-20C
Provider Type Product Number
- No reagents -