HPA025285

INSRR antibody from Sigma-Aldrich
IRR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025285
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025285, RRID:AB_1851814
Product name
Anti-INSRR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025285
Antibody type
Polyclonal
Antigen
Insulin receptor-related protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRAAC
QTRTLRFVSNVTEADRILLRWERYEPLEARDLLSL
IVYYKESPFQNATEHVGPDACGTQSWNLLDVELPL
SRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSP
HQGAQ
Storage
-20C
Provider Type Product Number
- No reagents -