Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000922-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000922-M01, RRID:AB_464348
- Product name
- CD5L monoclonal antibody (M01), clone 1C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CD5L.
- Antigen sequence
QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPS
GILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEE
VYDCSHDEDAGASCENPESSFSPVPEGVRL- Isotype
- IgG
- Antibody clone number
- 1C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CD5L monoclonal antibody (M01), clone 1C8. Western Blot analysis of CD5L expression in different cell lines.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CD5L is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CD5L transfected lysate using anti-CD5L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD5L MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol