Antibody data

Product number
H00000910-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000910-M06, RRID:AB_1204088
Product name
CD1B monoclonal antibody (M06), clone 2E4
Provider product page
Abnova Corporation - H00000910-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CD1B.
Antigen sequence
EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDL
QIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIF
RVYIFGFAREVQDFAGDFQMKY
Isotype
IgG
Antibody clone number
2E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -