SAB1401051

CD1B antibody from MilliporeSigma / Merck KGaA
CD1
No application information provided.

Antibody data

Product number
SAB1401051
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401051, RRID:AB_10609545
Product name
Anti-CD1B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB1401051
Antibody type
Polyclonal
Antigen
CD1B (NP_001755.1, 1 a.a. ~ 333 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSS
FTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKP
WSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGD
FQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLD
FLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMET
VRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLS
SGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQ
QGTQLGDILP
Storage
-20C
Provider Type Product Number
- No reagents -