HPA016960

GALK1 antibody from Sigma-Aldrich
GALK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016960
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016960, RRID:AB_1849430
Product name
Anti-GALK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016960
Antibody type
Polyclonal
Antigen
Galactokinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSN
VRHSLASSEYPVRRRQCEEVARALGKESLREVQLE
ELEAARDLVSKEGFRRARHVVGEIRRTAQA
Storage
-20C
Provider Type Product Number
- No reagents -