Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503847 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mevalonate Kinase (MVK) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MVK antibody: synthetic peptide directed towards the N terminal of human MVK
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGA
GLGSS AAYSVCLAAA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A diagnostic score for molecular analysis of hereditary autoinflammatory syndromes with periodic fever in children.
Gattorno M, Sormani MP, D'Osualdo A, Pelagatti MA, Caroli F, Federici S, Cecconi M, Solari N, Meini A, Zulian F, Obici L, Breda L, Martino S, Tommasini A, Bossi G, Govers A, Touitou I, Woo P, Frenkel J, Koné-Paut I, Baldi M, Ceccherini I, Martini A
Arthritis and rheumatism 2008 Jun;58(6):1823-32
Arthritis and rheumatism 2008 Jun;58(6):1823-32
No comments: Submit comment
No validations: Submit validation data