HPA016961

MVK antibody from Sigma-Aldrich
LRBP, MK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016961
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016961, RRID:AB_1854220
Product name
Anti-MVK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016961
Antibody type
Polyclonal
Antigen
Mevalonate kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLK
RSPALQILLTNTKVPRNTRALVAGVRNRLLKFPEI
VAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLE
ELIDMNQHHLNALGVGHASLDQLC
Storage
-20C
Provider Type Product Number
- No reagents -