HPA016961

MVK antibody from Atlas Antibodies
LRBP, MK
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016961
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016961, RRID:AB_1854220
Product name
Anti-MVK
Provider product page
Atlas Antibodies - HPA016961
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLK
RSPALQILLTNTKVPRNTRALVAGVRNRLLKFPEI
VAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLE
ELIDMNQHHLNALGVGHASLDQLC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -