HPA023219

C1orf204 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023219
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023219, RRID:AB_1845635
Product name
Anti-C1orf204 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023219
Antibody type
Polyclonal
Antigen
V-set and immunoglobulin domain-containing protein 8 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQD
KRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQ
VSDTATYECRVKKTTMATRKVIVTVQARPAVPMCW
TEGHMTYGNDVVLKCYASGGSQPLSYKWAK
Storage
-20C
Provider Type Product Number
- No reagents -