HPA028356

PEA15 antibody from Sigma-Aldrich
HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED, PED-PEA15, PED/PEA15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028356
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028356, RRID:AB_10602814
Product name
Anti-PEA15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028356
Antibody type
Polyclonal
Antigen
phosphoprotein enriched in astrocytes 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKIS
EEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLA
Storage
-20C
Provider Type Product Number
- No reagents -