HPA027218

DCAF8 antibody from Sigma-Aldrich
FLJ35857, H326, WDR42A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027218
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027218, RRID:AB_10602586
Product name
Anti-WDR42A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027218
Antibody type
Polyclonal
Antigen
DDB1 and CUL4 associated factor 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEE
EEEEQPRRRVQRKRANRDQDSSDDERALEDWVS
Storage
-20C
Provider Type Product Number
- No reagents -