HPA007037

TRPM6 antibody from Sigma-Aldrich
CHAK2, FLJ22628, HOMG, HSH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007037
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007037, RRID:AB_1078508
Product name
Anti-TRPM6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007037
Antibody type
Polyclonal
Antigen
Transient receptor potential cation channel subfamily M member 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPTLSCTPEPMTMSSPLSQAKIMQTGGGYVNWAFS
EGDETGVFSIKKKWQTCLPSTCDSDSSRSEQHQKQ
AQDSSLSDNSTRSAQSSECSEVGPWLQPNTSFWIN
PLRRYR
Storage
-20C
Provider Type Product Number
- No reagents -