HPA005839

RASD2 antibody from Atlas Antibodies
MGC:4834, Rhes, TEM2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005839
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005839, RRID:AB_1079745
Product name
Anti-RASD2
Provider product page
Atlas Antibodies - HPA005839
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFD
EVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKN
DHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNT
NVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAF
HPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYI
KAKVLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -