Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405750 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQT
QNFLC GPLRYTIEDG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of CAR in SW480 and HepG2 cells during G1 is associated with cell proliferation.
Osabe M, Sugatani J, Takemura A, Yamazaki Y, Ikari A, Kitamura N, Negishi M, Miwa M
Biochemical and biophysical research communications 2008 May 16;369(4):1027-33
Biochemical and biophysical research communications 2008 May 16;369(4):1027-33
No comments: Submit comment
No validations: Submit validation data