H00002214-M03A

FCGR3A antibody from Abnova Corporation
CD16, CD16a, FCG3, FCGR3

Antibody data

Product number
H00002214-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002214-M03A, RRID:AB_1574842
Product name
FCGR3A monoclonal antibody (M03A), clone 2B11
Provider product page
Abnova Corporation - H00002214-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FCGR3A.
Antigen sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAY
SPEDNSTQWFHNESLISSQASSYFIDAATVDDSGE
YRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEE
DPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSD
FYIPKATLKDSGSYFCRGLVGSKNVSSETVNITIT
QGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLY
FSVKTNIRSSTRDWKDHKFKWRKDPQDK
Isotype
IgG
Antibody clone number
2B11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -