HPA028051

LMX1A antibody from Sigma-Aldrich
LMX1, LMX1.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028051
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028051, RRID:AB_10599731
Product name
Anti-LMX1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028051
Antibody type
Polyclonal
Antigen
LIM homeobox transcription factor 1, alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDGLKMEENFQSAIDTSASFSSLLGRAVSPKSVCE
GCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLET
TCFYRDKK
Storage
-20C
Provider Type Product Number
- No reagents -