HPA007039

MAP3K10 antibody from Atlas Antibodies
MEKK10, MLK2, MST
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007039
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007039, RRID:AB_1079357
Product name
Anti-MAP3K10
Provider product page
Atlas Antibodies - HPA007039
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPSGFEHKITVQASPTLDKRKGSDGASPPASPSII
PRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPK
KEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLG
EGSKQWSSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -