HPA007039

MAP3K10 antibody from Sigma-Aldrich
MEKK10, MLK2, MST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007039
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007039, RRID:AB_1079357
Product name
Anti-MAP3K10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007039
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPSGFEHKITVQASPTLDKRKGSDGASPPASPSII
PRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPK
KEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLG
EGSKQWSSS
Storage
-20C
Provider Type Product Number
- No reagents -