Antibody data

Product number
H00008548-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008548-M02, RRID:AB_1137104
Product name
BLZF1 monoclonal antibody (M02), clone 2E10
Provider product page
Abnova Corporation - H00008548-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BLZF1.
Antigen sequence
KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEK
MAETVLRILDPVTCKESSPDNPFFESSPTTLLATK
KNIGRFHPYTRYENITFNCCNHCRGELIAL
Isotype
IgG
Antibody clone number
2E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -