HPA027331

BLZF1 antibody from Sigma-Aldrich
JEM-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027331
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027331, RRID:AB_1845380
Product name
Anti-BLZF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027331
Antibody type
Polyclonal
Antigen
Golgin-45 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVRS
RKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEV
KAVRI
Storage
-20C
Provider Type Product Number
- No reagents -