HPA023778

C1orf112 antibody from Atlas Antibodies
FLJ10706
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023778
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023778, RRID:AB_1848665
Product name
Anti-C1orf112
Provider product page
Atlas Antibodies - HPA023778
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SCMFALLLADRSWLLEQHTLEAFTQFAEGTNHEEI
VPQCLSSEETKNKVVSFLEKTGFVDETEAAKVERV
KQEKGIFWEPF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -