HPA024451

C1orf112 antibody from Sigma-Aldrich
FLJ10706
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024451
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024451, RRID:AB_1848667
Product name
Anti-C1orf112 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024451
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf112 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FANSLLHYAKEFLPFLSDSCCTLHQLYLQIHSKFP
PSLYATRISKAHQEEIAGAFLVTLDPLISQLLTFQ
PFMQVVLDSKLDLPCELQFPQCLLLVVVMDKLPSQ
PKEVQTL
Storage
-20C
Provider Type Product Number
- No reagents -