HPA023742

KIFAP3 antibody from Atlas Antibodies
FLA3, KAP-1, KAP3, SMAP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023742
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023742, RRID:AB_1857286
Product name
Anti-KIFAP3
Provider product page
Atlas Antibodies - HPA023742
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIK
ETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDE
EWAKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -