HPA007041

ACVRL1 antibody from Sigma-Aldrich
ACVRLK1, ALK1, HHT, HHT2, ORW2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007041
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007041, RRID:AB_1078097
Product name
Anti-ACVRL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007041
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase receptor R3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLV
REEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCD
SHLCNHNVSLVLEATQPPSEQPGTDGQL
Storage
-20C
Provider Type Product Number
- No reagents -