Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP41487_P050 - Provider product page
- Provider
- Aviva Systems Biology
- Proper citation
- Aviva Systems Biology Cat#ARP41487_P050, RRID:AB_10866859
- Product name
- Fmo1 antibody - N-terminal region (ARP41487_P050)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against Fmo1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
LWRFTEHVEEGRASLYNSVVSNSSKEMSCYSDFPF
PEDYPNFVPNSLFLE- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Handling
- Add 50 µl of distilled water. Final anti-Fmo1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image
- Experimental details
- WB Suggested Anti-Fmo1 AntibodyTitration: 1.0µg/ml. Positive Control: Rat Muscle