HPA025766

PRRC2C antibody from Sigma-Aldrich
BAT2D1, BAT2L2, KIAA1096, XTP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025766
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025766, RRID:AB_1845277
Product name
Anti-BAT2D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025766
Antibody type
Polyclonal
Antigen
BAT2 domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVRPHHTDANNQSACFEAPDQKTLSTPQEERISAV
ESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVT
SRCIDSKEP
Storage
-20C
Provider Type Product Number
- No reagents -