HPA007042

TTN antibody from Sigma-Aldrich
CMD1G, CMH9, CMPD4, FLJ32040, LGMD2J, MYLK5, TMD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007042
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007042, RRID:AB_1080292
Product name
Anti-TTN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007042
Antibody type
Polyclonal
Antigen
Titin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRF
VESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQ
KLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY
RYKVSYNKQTGECKLVISMTFADDAGEYT
Storage
-20C
Provider Type Product Number
- No reagents -