HPA025034

KLHL20 antibody from Sigma-Aldrich
KHLHX, KLEIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025034
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025034, RRID:AB_1852578
Product name
Anti-KLHL20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025034
Antibody type
Polyclonal
Antigen
Kelch-like protein 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVG
LAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRL
YGGMNYRRLGGGVGVIKMTHCESHIW
Storage
-20C
Provider Type Product Number
- No reagents -