HPA026506

DARS2 antibody from MilliporeSigma / Merck KGaA
FLJ10514, mtAspRS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026506
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026506, RRID:AB_1847482
Product name
Anti-DARS2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026506
Antibody type
Polyclonal
Antigen
Aspartyl-tRNA synthetase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDES
AASVKKILCEAPVESVVQVSGTVISRPAGQENPKM
PTGEIEIKVKTAELLNACKKLPFEIKNFVKK
Storage
-20C
Provider Type Product Number
- No reagents -