HPA026528

DARS2 antibody from Sigma-Aldrich
FLJ10514, mtAspRS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026528
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026528, RRID:AB_1847483
Product name
Anti-DARS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026528
Antibody type
Polyclonal
Antigen
Aspartyl-tRNA synthetase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADH
FNQEILPVFLNANRNWNSPVANFIMESQRLELIRL
METQEEDVVLLTA
Storage
-20C
Provider Type Product Number
- No reagents -